PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.6879s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 327aa    MW: 34582.4 Da    PI: 9.4179
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.6879s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37.2e-3868127362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             e alkcprCdstntkfCy+nny+ sqPr+fCk+CrryWt+GGalr vPvGgg+r+nkks+
  SapurV1A.6879s0010.2.p  68 EVALKCPRCDSTNTKFCYFNNYNFSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKSK 127
                             6689*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3451123IPR003851Zinc finger, Dof-type
PfamPF027015.6E-3270125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34871125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVFSSAPFYL DPPNWQQQPG QQPGASNETP QLPPLPPPAH VGGGGTAGSI RPGSMADRAR  60
LAKIPHPEVA LKCPRCDSTN TKFCYFNNYN FSQPRHFCKT CRRYWTRGGA LRSVPVGGGC  120
RRNKKSKSQS SSKSTVSSER EVGSTSSSTS ALPSEVSGHL PHQPSQLPFM SSLQNLAQFG  180
EGNIGLNFGG IQGQLGSTSG PSSGQADMGF PIGINSGMSG SALLSAGGVH QFPFFEFSPS  240
GLYPLQSEGA ETPINVNGDS QLQSMTSSSR VSQLAPVKTE GNQGLNLSKA PYSGTVVPQN  300
NQYYWGGNTW TDLSGLNSSF TSHLFR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000263.10.0PREDICTED: dof zinc finger protein DOF2.2-like isoform X2
TrEMBLB9GJP70.0B9GJP7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24540.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.14e-46Dof family protein